PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096328.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 131aa    MW: 15013.6 Da    PI: 8.3889
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096328.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.91.2e-4252127277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqve+C+ad+++a+ yhrrhkvCe+h+ka+vv+++gl+qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++
  XP_011096328.1  52 CQVEDCTADMADARPYHRRHKVCEFHAKAAVVFLAGLQQRFCQQCSRFHELQEFDEAKRSCRRRLAGHNERRRKSS 127
                     **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375758.1E-571131IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.102.5E-3444113IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.13749126IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-3851129IPR004333Transcription factor, SBP-box
PfamPF031101.5E-3252125IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
METSKEAGKR IAELDEEGEE DEDAGEDNKK KRALSPSKRR VSGAGGSTQR SCQVEDCTAD  60
MADARPYHRR HKVCEFHAKA AVVFLAGLQQ RFCQQCSRFH ELQEFDEAKR SCRRRLAGHN  120
ERRRKSSYDS H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-4244125384squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096328.11e-91PREDICTED: squamosa promoter-binding protein 1
SwissprotQ387418e-67SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A075FJ685e-69A0A075FJ68_SALMI; SQUAM
STRINGSolyc02g077920.2.12e-55(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.21e-45squamosa promoter binding protein-like 4